PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g62510.3.p
Common NameBRADI_2g62510, LOC100844769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 265aa    MW: 30135.9 Da    PI: 8.7151
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g62510.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-143784148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed +lv  v+++G ++W+  a+  g++R++k+c++rw +yl
  Bradi2g62510.3.p 37 KGPWTEQEDMKLVWFVRLFGERRWDFLAKVSGLNRSGKSCRLRWVNYL 84
                      79********************************************97 PP

2Myb_DNA-binding57.23.8e-1890134147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr++++E+ l v++++++G++ W++Iar m+ gRt++++k++w+++
  Bradi2g62510.3.p  90 RGRMSPDEERLVVELHAKWGNR-WSRIARSMP-GRTDNEIKNYWRTH 134
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0613284IPR017930Myb domain
SuperFamilySSF466894.49E-2836131IPR009057Homeodomain-like
SMARTSM007176.0E-133686IPR001005SANT/Myb domain
PfamPF002492.1E-133784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-193891IPR009057Homeodomain-like
CDDcd001671.95E-83984No hitNo description
PROSITE profilePS5129425.45485139IPR017930Myb domain
SMARTSM007173.1E-1689137IPR001005SANT/Myb domain
PfamPF002496.8E-1690134IPR001005SANT/Myb domain
CDDcd001671.12E-1092134No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2392137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MKQTSKQQLG KTKKMAIEAG KKKKEECLSA AAGVVRKGPW TEQEDMKLVW FVRLFGERRW  60
DFLAKVSGLN RSGKSCRLRW VNYLHPDLKR GRMSPDEERL VVELHAKWGN RWSRIARSMP  120
GRTDNEIKNY WRTHTRKLKH KHRHHQEEEE STKVATSASA STSTSAATTS PSSTSSSSDV  180
EVVQEAASKE DEQQQLLCAG TMDDGQLLWN DDGIDAYASW SGATSSMMMV PSSPVWPWDD  240
HYCCPTDSLW GHDEVFEYKK MLHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25371377106B-MYB
1gv2_A7e-26371374103MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-253713758157MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-253713758157MYB PROTO-ONCOGENE PROTEIN
1mse_C8e-26371374103C-Myb DNA-Binding Domain
1msf_C8e-26371374103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519391e-112JF951939.2 Triticum aestivum clone TaMYB56 MYB-related protein mRNA, complete cds.
GenBankJN1913471e-112JN191347.1 Triticum aestivum MYB13-3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232888.10.0PREDICTED: transcription factor MYB59-like
TrEMBLI1HVT50.0I1HVT5_BRADI; Uncharacterized protein
STRINGBRADI2G62510.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.35e-57myb domain protein 59